PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01465.1.g00130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family BES1
Protein Properties Length: 926aa    MW: 99190.6 Da    PI: 8.4586
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01465.1.g00130.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.73.8e-655226602144
                        DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaa 82 
                                   g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlkALcreAGwvvedDGt yrkg+kp+     +
  Zpz_sc01465.1.g00130.1.am.mk 522 GVGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVEDDGTAYRKGCKPP----PG 598
                                   789************************************************************************....78 PP

                        DUF822  83 gssasaspesslq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvls 144
                                    +sa +sp+ss+q +s+ ss++aspv+sy+asp+sssfpsp++lds+++a ++ +lp+l+ l+
  Zpz_sc01465.1.g00130.1.am.mk 599 AASAGMSPCSSSQlLSAPSSSFASPVPSYHASPASSSFPSPTRLDSNNNA-PSLMLPFLRGLP 660
                                   88999********9*********************************887.678888877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.600.101.4E-7450276IPR008949Isoprenoid synthase domain
SuperFamilySSF485761.53E-6553276IPR008949Isoprenoid synthase domain
CDDcd006854.19E-5477275No hitNo description
PfamPF003487.3E-3879276IPR000092Polyprenyl synthetase
PROSITE patternPS007230129145IPR000092Polyprenyl synthetase
PfamPF111453.6E-5269372IPR021319Protein of unknown function DUF2921
PfamPF056879.0E-61523647IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0043693Biological Processmonoterpene biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0009513Cellular Componentetioplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004161Molecular Functiondimethylallyltranstransferase activity
GO:0004311Molecular Functionfarnesyltranstransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MALAFHPLAA SRVYLSPLLS GPAATAPVTS HRRRFSAIVA TAVASTVREF DFKAYMGELA  60
AAVNQALDAA IPAGEPPAAL HEAMRYALLA GGKWVRPALC LAACGVAGGR EAWAMPPAAA  120
LEMVHTMSLI HDDLPCMDDD DLRRGKPTCH VVFGEPIAVL AGDALLSLAF RHMASVHSYP  180
KDVDPDKHPA RVVRAIGELA RCIGSEGLVA GQVVDLEMTG STEIVPLEKL EYIHLHKTAA  240
LLEASVVIGA IIGGGSDEQI ERLRKYARSI GLLFQFCMRS APMALRHGTA RTAVNVSGCM  300
SFTVTRGHCC APMEPYESPE FELGSGFATL HVVFERVYME MMSPAGNDDH DHGGGERVLF  360
MVGNAVLPVC GSNGSDPWDW AKRPKTGSTD RYYFDRSSSH MPPARRGRAE ATGPRDSSSL  420
VAHGRRIRES RSGAVTVDPF DRPSGLLHHP RTHRAAWPGP ERESSKRGAA RHDTSTSITL  480
HSAAAKPRLS PPRHPFLSVG ERAEERREGR GASMTSGTPA GGVGRTPTWK ERENNKRRER  540
RRRAIAAKIF TGLRALGNYK LPKHCDNNEV LKALCREAGW VVEDDGTAYR KGCKPPPGAA  600
SAGMSPCSSS QLLSAPSSSF ASPVPSYHAS PASSSFPSPT RLDSNNNAPS LMLPFLRGLP  660
TLPPLRVSNS APATPPLSSP TAAASRPPTK VRRPDWDAVA VVDPFRHPFF AVSAPASPTR  720
ARRREHPDTI PECDESDVST VDSGRWISFQ MAPTTAPASP AYNLVNRGGG STSNPMELDG  780
AAPAERGRGG PEFEFDKGRV VTPWEGERIH EVAAEELELT LGVGAKPDSP HGELGSLCSC  840
ELHHSRQEAI EPEINPVACA DEKADCCGAM GISVAYRSFL PVVRVAGITK ARRALRVWLP  900
GSRPTASSCP VDCSGSLVAP RARGWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5e8l_A1e-93502754224Heterodimeric geranylgeranyl pyrophosphate sy
5e8l_B1e-93502754224Heterodimeric geranylgeranyl pyrophosphate sy
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.26e-46BES1 family protein